PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G053900.1
Common NameB456_001G053900, LOC105785701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LFY
Protein Properties Length: 407aa    MW: 44968.6 Da    PI: 7.0513
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G053900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY636.83.4e-19413881386
             FLO_LFY   1 mdpeafsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklr......eleelfkayGvryltvakiaelGftvstLvdmkde 84 
                         mdpe+f++  +fkwdpr  +a++parl+e  a++++p+++a+aaaa  +       ++eelf+ayG+ry+t+akiaelGftv+tL++mk+e
  Gorai.001G053900.1   1 MDPETFASGsFFKWDPRGLMAPTPARLVEAVAAVPQPQAVAVAAAAAFMGrprelgGIEELFQAYGIRYYTAAKIAELGFTVNTLLGMKEE 91 
                         9****977559*********99999**999999998855555544444334667779********************************** PP

             FLO_LFY  85 elddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkll......sedeetaldalsqeglseepvqeekeaagsggeglg 169
                         eld++m+s+s+ifr++llvGeryGikaavraerrrleee+  ++rr+l+      ++  ++aldalsqeglseepvq+ekeaagsgg+g  
  Gorai.001G053900.1  92 ELDEMMNSVSQIFRWELLVGERYGIKAAVRAERRRLEEED--SRRRHLVlgdtttTTTAANALDALSQEGLSEEPVQQEKEAAGSGGGG-- 178
                         **************************************88..66666663554333333449***********************9999.. PP

             FLO_LFY 170 eaelvaaeekkseeekkkaskkkqkrkkkkelkseededee.eeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqC 259
                         ++e+v         ++k++   ++++ +kk ++ ++ ++ e  ++d+++ ++g +g erqrehPfivtepgevargkknGLDYLf+LyeqC
  Gorai.001G053900.1 179 TWEMVIGGG-----RRKQQ---RRRKGQKKVVEVDNGDEFEgGDDDDENGDGGGGGYERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQC 261
                         999999883.....23333...22222333333334444440444445555677788********************************** PP

             FLO_LFY 260 refLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaar 350
                         r+fL+qvq+iak+rGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplv+iaar
  Gorai.001G053900.1 262 RDFLIQVQNIAKDRGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRQACYKPLVSIAAR 352
                         ******************************************************************************************* PP

             FLO_LFY 351 qgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                         qgwdida+fnahprL+iWYvPtkLrqLCh+er+ a+
  Gorai.001G053900.1 353 QGWDIDAIFNAHPRLAIWYVPTKLRQLCHAERNGAA 388
                         ********************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.6E-2061387IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MDPETFASGS FFKWDPRGLM APTPARLVEA VAAVPQPQAV AVAAAAAFMG RPRELGGIEE  60
LFQAYGIRYY TAAKIAELGF TVNTLLGMKE EELDEMMNSV SQIFRWELLV GERYGIKAAV  120
RAERRRLEEE DSRRRHLVLG DTTTTTTAAN ALDALSQEGL SEEPVQQEKE AAGSGGGGTW  180
EMVIGGGRRK QQRRRKGQKK VVEVDNGDEF EGGDDDDENG DGGGGGYERQ REHPFIVTEP  240
GEVARGKKNG LDYLFHLYEQ CRDFLIQVQN IAKDRGEKCP TKVTNQVFRY AKKAGASYIN  300
KPKMRHYVHC YALHCLDEEA SNALRRAFKE RGENVGAWRQ ACYKPLVSIA ARQGWDIDAI  360
FNAHPRLAIW YVPTKLRQLC HAERNGAAAV AAGSSSVSGG HDHMGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-1122263992183PROTEIN LEAFY
2vy1_A1e-1122263992183PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7951310.0JN795131.1 Gossypium hirsutum LFY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467284.10.0PREDICTED: floricaula/leafy homolog isoform X1
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLA0A0D2LV380.0A0A0D2LV38_G
STRINGPOPTR_0015s11820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-153floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]